Search the Site:
FreedomYou News
  • ...April 18, 2012...
    Ron's New Blog
    It's been a long time coming, but finally a FreedomYou blog. Let’s journey this road of freedom together.

  • ...March 01, 2012...
    New FreedomYou Site
    We have expanded the articles from 210 to 334. After a two year labor of love, read about the story behind our new site. 
    
Related Articles
Share This Page:
Visit Us On Facebook

FreedomYou Products

For 12 Years an International Best Selling Series

Read  Book Reviews

      • Shipping: 3-5 business days within North America. 
      • E-Books are an immediate  download. Learn More


FreedomYou has found Paypal to be the most 
secure checkout system in the world : learn more


You can also: Order by check or money order
IDnamedescriptiondescription_longoption1titleoptions1option2titleoptions2option3titleoptions3unitpriceinventoryimagelinkshippingweightcategoryidprioritylocaleidproductcodesiteidpurchlink1purchlink2unitprice2specialoffersavingsdownloadlinkshippingcanadashippingoverseasrecommendshortrecommendlongproductfileidreducedfromsupplieractivespecialofferssellboxlookinsidelinkdbspecialoffers
Steps To Freedom Program (4 books)
Print Book Price: $53.00
Digital E-Book Price: $30.98
  • $14 savings!
  • Fasting To Freedom
  • North American Diet
  • Foundation To All Freedom
  • Whole Foods & Healing Recipes
There is far more to becoming free from an unhealthy lifestyle then just learning how to eat better. If only it were that simple. What diet programs do not talk about is how to become free from emotional dependence on food. The Steps To Freedom Program is designed, not only to provide the best nutritional education, but also to equip you for the challenging step by step spiritual journey toward lifelong freedom, leaving that old, addictive lifestyle far behind forever. Freedom never tasted so good!
Fasting To Freedom (Revised Edition)
Print Book Price: $17.00
Digital E-Book Price: $11.49
  • everything you need to know to fast safely
  • detoxification, healing, colon cleansing
  • spiritual renewal, self-control, deepened contentment
  • refreshed relationship with God.
  • how to prepare and safely end a fast
  • overcome emotional battles familiar with fasting
  • delicious fresh juice recipes
  • many encouraging fasting testimonies
  • 266 pgs. soft cover
Whole Foods & Healing Recipes
Print Book Price: $18.00
Digital E-Book Price: $11.49
  • Complete guide to natural, delicious recipes
  • learn how to pick ripe fruit
  • delicious butter replacers and healthy vegetable soups
  • discover natural sweeteners
  • omega 3 and 6 salad dressings
  • super tasty avocado dips
  • dozens of rare raw food recipes
  • herb and spice guide
  • how to furnish your new health conscious kitchen
  • 290 pgs. soft cover
North American Diet
Print Book Price: $15.00
Digital E-Book Price: $11.49
  • What not to eat and why
  • what is making you sick
  • stop premature aging
  • toxic free diet
  • see food from a cellular level
  • the danger of hydrogenated oils and trans-fatty acids
  • shocking information on processed foods
  • 134 pgs. soft cover
Foundation To All Freedom
Print Book Price: $17.00
Digital E-Book Price: $11.49
  • Awaken the deepest you
  • awaken from spiritual paralysis
  • gain control over your thinking
  • examining the media message
  • break old patterns, hopelessness and depression
  • re-establishing meaningful living
  • fulfill the heart-dream you were born with
  • learn the secret of developing spiritual self-discipline
  • 182 pgs. soft cover
The Know-It-All Health Nut
Digital E-Book Price: $11.49
  • Permanent weight loss
  • Reverse aging. Seriously!
  • Choosing the best fats, carbs and protein foods
  • Strategic grocery shopping
  • What do my cells really need
  • How to make the hard changes
  • A fun and easy read
  • 229 pages
The Know-It-All Health Nut was written out of a mix of research and personal lessons learned while journeying from sickness to health. I believe it will be the most informative, honest and inspirational book you will ever read on how to make the hard choices so you can achieve a lifetime of vitality.
Champion Juicer - Household
Price: $239.00
SPECIAL OFFER
Receive the Steps To Freedom Series of 4 E-books for FREE with the purchase of any juicer!
  • masticating juicer for better quality juice
  • nut butters
  • baby food
  • frozen smoothies
  • 10 year limited warranty
  • heavy duty 1/3 HP G.E. motor, 540 watts
  • 1725 RPM
  • stainless steel motor shaft
  • family owned for over 50 years
  • over 2 million sold worldwide
The Champion is far more than just a juicer. In fact with this single machine you can produce many of our healthy recipes found on Freedomyou. This company has been around for over 50 years and is recognized by most health advocates and writers as the finest machine in the world. It will last a lifetime. Easy to clean, easy to use. The juice flowing from a Champion juicer is different than the more common centrifugal juicers.
Champion Juicer - Commercial
Price: $259.00
SPECIAL OFFER
Receive the Steps To Freedom Series of 4 E-books for FREE with the purchase of any juicer!
  • masticating juicer for better quality juice
  • nut butters
  • baby food
  • frozen smoothies
  • 10 year limited warranty
  • 1/3 HP G.E. motor, 650 watts, 1725 RPM
  • stainless steel motor shaft
  • family owned for over 50 years
  • over 2 million sold worldwide
  • variable 110/220 Volt 50/60 Hertz can be converted for domestic or overseas use.
All the qualities of the above Household Unit with an even stronger motor which boosts starting torque and allows the motor to run cooler increasing durability and performance under heavy use.
Champion Grain Mill Attachment
Price: $90.00
  • quickly mill all types of grain into fresh flour
  • adjustable for fine or coarse flour
  • heavy duty construction
  • easy to attach
  • coffee grinder
  • peppercorn
  • produce soy flour
Add the grain mill attachment and now you are talking about the single most powerful machine to positively effect health, producing whole grains with essential fatty acids intact. The Grain Mill attaches quickly and easily to your Champion Juicer, eliminating the need for a separate appliance on your countertop. Wheat, rye, oats, barley or rice is ground with razor sharp blades designed to shear-cut whole grains with dust-free efficiency. Turning the unit's front attachment knob allows you to choose between fine or coarse grain settings, while the Grain Mill's rugged die-cast aluminum construction allows you to grind coffee beans, soy beans, peppercorns and more.

E-Book Return Policy: There are no refunds for E-Books. Electronic Files that are damaged or can not be opened for any reason will be replaced. For assistance contact info@freedomyou.com

There is no refund available for hard copy books. Any books damaged during shipping will be replaced.

Check out our Juicer Return Policy

Give Us Your Feedback!
Average
Rating
4.5
CLICK on the STARS below to give us your rating & comments:
Your Comments
What a pleasure it is to have found your books! I am absolutely enjoying the connection you have placed on the masterpiece within each of us and the Spirit with which connects us to our Loving Creator. Thank you for this excellent writing!
Sue Ann
I have read the first two books and am about 1/3 done with the third. What wonderful information. And it’s written to where even I can understand it. I made fried chicken strips and fried French fries last night for dinner. I took a few bites and just could not go on. All I could do was think of what it was doing to me. This morning my husband and I both had our first glass of fresh apple juice. They both tasted so good and alive. Not only a sight for poor eyes, but also a feast for the senses! I just want to thank you all for these books.
Lynne
Your books have been a blessing and a curse for me as it has made me aware of everything I am doing to keep my body sick. Thank you, your work is a blessing.
Raychel
Dear Mr. Lagerquist, despite not being a religious person per se, I wanted to write and state that I enjoyed your books and appreciate the information you have published. These facts about food are worth their own apostolic movement in your books and I teach these things daily in my job as a registered nurse.
Martin RN
I just finished 3 day water fast. I just purchased your Whole Foods & Healing Recipes e-book. Great stuff! Thank you.
Rob
I had bought all your e-books. I'm now devouring those and they are really changing my perspectives about so many things. Thank you, Ron, for your passionate and inspired writing. I'm particularly enjoying "Foundation to All Freedom". I've been in bondage to compulsive overeating and a North American diet for many years. I did want to tell you a few benefits I've already been experiencing during my fast. My sinuses are starting to feel so clean and clear! I've lost about 5 lbs. so far, and I know more will melt off as I go. I'm starting to feel more energy too. I've never been so hopeful about regaining my health and wholeness. Thank you for being willing to be a servant for the Lord. Your website, as well as both your testimonies, has really encouraged me.
Andrea
I purchased all 4 of your books online and the Foundation to All Freedom has blessed my soul tremendously it is also a good witnessing tool.
Deneen
I decided to do some research and God led me to Freedomyou. It changed my life forever. I gave my book away and I tell everyone I can about this site. I know that God birthed and ordained your ministry and thank God for it. With much appreciation.
Patty
I have read your book “Fasting to Freedom”. I could not put it down. I devoured every word and began to feel like I had made some sort of contact with a person that I could relate to
Brent
1
Page size:
select
Page: of 1
Items 1 to 15 of 9
My Top Pick Juicers
Sponsored Links